PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10023711
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 305aa    MW: 34855 Da    PI: 9.4152
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10023711genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.39.7e-202572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll+d+vk++G g+W++++r  g++R +k+c++rw +yl
      Lus10023711 25 KGPWTAEEDKLLIDYVKLHGEGRWNSVSRLAGLKRNGKSCRLRWVNYL 72
                     79********************************************97 PP

2Myb_DNA-binding52.41.2e-1678122147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
      Lus10023711  78 RGQITPQEETIILELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 122
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0852072IPR017930Myb domain
SuperFamilySSF466899.54E-3122119IPR009057Homeodomain-like
SMARTSM007171.2E-162474IPR001005SANT/Myb domain
PfamPF002499.0E-182572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-232679IPR009057Homeodomain-like
CDDcd001672.16E-122772No hitNo description
PROSITE profilePS5129424.55973127IPR017930Myb domain
SMARTSM007177.0E-1577125IPR001005SANT/Myb domain
PfamPF002491.5E-1478122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2480126IPR009057Homeodomain-like
CDDcd001671.37E-1082123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MSWGVMSGDL GWGSSVVVEE VGWRKGPWTA EEDKLLIDYV KLHGEGRWNS VSRLAGLKRN  60
GKSCRLRWVN YLRPDLKRGQ ITPQEETIIL ELHARWGNRW STIARSLPGR TDNEIKNYWR  120
THFKKKTKPS PSAAAADTSD KARNRLLKRQ HFHQQQKEQQ QIMQAQQQYQ HQHQHQQLLW  180
QLNQLDIKKI MSLLLDDNEY SSNNNNNQNM AQFSGRREVD PTPAATTNTE NSIYPSQEQH  240
GGYYANGIYP YSPPFLMAPA EANQEILSTP WIDGLWSLED LHAAGRATTT TTTSSISNLV  300
APFC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-262512727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311700.18e-95myb family transcription factor family protein
TrEMBLB9HKW39e-95B9HKW3_POPTR; Myb family transcription factor family protein
STRINGPOPTR_0008s17350.13e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.12e-68myb domain protein 305